PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_06965.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 509aa    MW: 56672.8 Da    PI: 4.9742
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_06965.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.87.6e-48151401128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelvv+yLk+k+++kkl++  +i e+d+yk++P++Lp k  +++++++w+fFs+rd+k+  g r++rat +gyWk
  Rsa1.0_06965.1_g00002.1  15 LAPGFRFHPTDEELVVYYLKRKIRRKKLRV-AAIGETDVYKFDPEELPgKaLYNTGDRQWFFFSSRDRKQ--GGRSSRATGHGYWK 97 
                              579***************************.88***************7435667999**********86..89************ PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atg d+ +++ +++ vg kktLvf++grapkge+t+Wvmhey+l
  Rsa1.0_06965.1_g00002.1  98 ATGVDRVIKC-NSRPVGEKKTLVFHRGRAPKGERTNWVMHEYTL 140
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5411163IPR003441NAC domain
PROSITE profilePS5100552.07715163IPR003441NAC domain
PfamPF023653.0E-2617140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010224Biological Processresponse to UV-B
GO:0031930Biological Processmitochondria-nucleus signaling pathway
GO:1900409Biological Processpositive regulation of cellular response to oxidative stress
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
METSRGSRPA GDRVLAPGFR FHPTDEELVV YYLKRKIRRK KLRVAAIGET DVYKFDPEEL  60
PGKALYNTGD RQWFFFSSRD RKQGGRSSRA TGHGYWKATG VDRVIKCNSR PVGEKKTLVF  120
HRGRAPKGER TNWVMHEYTL HKEELKMCGD VTHNYVLYKI FKKSGSGPKN GEQYGAPFVE  180
EEWAEDDDEV DEADAVHVPT NQLMVSAGMG NNNNIWADGG GLNQSELNEN DIQELMRQVT  240
EETGVSSHVA NDNPVNLAED EYLEIDDLLL PGPEPCYVDQ EESAVLNGND FFDVDSYIGD  300
FDATNPQTEP VGVVGLNNGV VHSLPVTDQA NNNQFQQQTW KNQDSNWPLR NSYTRKISSE  360
SWTHELINND EVTVCGYGET PGTGDASEFT NPLTCAVNIA KGEEATKDES SQFTSSVWSF  420
LESIPASPAF ASESPIVNLN IVRISSLGGR YRFNSKSTSS NVVVRKKSGE NNKEKNHKGF  480
LCLSIIGALC ALSWVMLGTM GVSGRSLLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-44916914174NAC domain-containing protein 19
3swm_B1e-44916914174NAC domain-containing protein 19
3swm_C1e-44916914174NAC domain-containing protein 19
3swm_D1e-44916914174NAC domain-containing protein 19
3swp_A1e-44916914174NAC domain-containing protein 19
3swp_B1e-44916914174NAC domain-containing protein 19
3swp_C1e-44916914174NAC domain-containing protein 19
3swp_D1e-44916914174NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13542KIRRKKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00176DAPTransfer from AT1G32870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747560.0KF974756.1 Brassica napus NAC transcription factor 13-1 (NAC13-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592976.10.0PREDICTED: NAC domain-containing protein 13
SwissprotF4IED20.0NAC13_ARATH; NAC domain-containing protein 13
TrEMBLA0A0D3D7A30.0A0A0D3D7A3_BRAOL; Uncharacterized protein
STRINGBra012342.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153171517
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32870.11e-178NAC domain protein 13